SCOPe 2.07: Domain d6cmqc1: 6cmq C:107-218

Lineage for d6cmqc1 (6cmq C:107-218)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.0: automated matches [191409] (1 protein)
   not a true family

6. Protein automated matches [190561] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187549] (78 PDB entries)

8. Domain d6cmqc1: 6cmq C:107-218 [360207]
   Other proteins in same PDB: d6cmqa2, d6cmqb2, d6cmqc2, d6cmqd2
   automated match to d4nwga2

Details for d6cmqc1

PDB Entry: 6cmq, 2.9 Å

PDB Description: structure of human shp2 without n-sh2 domain

PDB Compounds: (C:) Tyrosine-protein phosphatase non-receptor type 11

SCOPe Domain Sequences for d6cmqc1:

Sequence, based on SEQRES records:

>d6cmqc1 d.93.1.0 (C:107-218) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ptserwfhghlsgkeaeklltekgkhgsflvresqshpgdfvlsvrtgddkgesndgksk
vthvmircqelkydvgggerfdsltdlvehykknpmvetlgtvlqlkqplnt

Sequence, based on observed residues (ATOM records):

>d6cmqc1 d.93.1.0 (C:107-218) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ptserwfhghlsgkeaeklltekgkhgsflvresqshpgdfvlsvrtthvmircydvggg
erfdsltdlvehykknpmvetlgtvlqlkqplnt

Timeline for d6cmqc1:

• d6cmqc1 is new in SCOPe 2.07-stable
  
• d6cmqc1 appears in the current release, SCOPe 2.08