Lineage for d5zz6b2 (5zz6 B:80-207)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2454167Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2454168Protein automated matches [190069] (309 species)
    not a true protein
  7. 2457167Species Thermotoga maritima [TaxId:243274] [224971] (9 PDB entries)
  8. 2457182Domain d5zz6b2: 5zz6 B:80-207 [360082]
    Other proteins in same PDB: d5zz6a1, d5zz6b1, d5zz6c1, d5zz6d1
    automated match to d1xcba2
    complexed with adp, nad

Details for d5zz6b2

PDB Entry: 5zz6 (more details), 2.2 Å

PDB Description: redox-sensing transcriptional repressor rex
PDB Compounds: (B:) Redox-sensing transcriptional repressor Rex 1

SCOPe Domain Sequences for d5zz6b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zz6b2 c.2.1.0 (B:80-207) automated matches {Thermotoga maritima [TaxId: 243274]}
kkewklvvvgagnigravanytvmkekgfriigifdsdpskigkeaapgltvsdvselek
fveehgveigviavpaehaqeiaerlekagikgilnfapvkikvsvpveniditaslrvl
tfeivrrn

SCOPe Domain Coordinates for d5zz6b2:

Click to download the PDB-style file with coordinates for d5zz6b2.
(The format of our PDB-style files is described here.)

Timeline for d5zz6b2: