Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.5: Flavoproteins [52218] (9 families) |
Family c.23.5.0: automated matches [191330] (1 protein) not a true family |
Protein automated matches [190158] (30 species) not a true protein |
Species Escherichia coli [TaxId:83333] [259351] (5 PDB entries) |
Domain d6etbb2: 6etb B:250-401 [359821] Other proteins in same PDB: d6etba1, d6etbb1 automated match to d4d02a2 complexed with fe, fmn, o, oxy; mutant |
PDB Entry: 6etb (more details), 1.91 Å
SCOPe Domain Sequences for d6etbb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6etbb2 c.23.5.0 (B:250-401) automated matches {Escherichia coli [TaxId: 83333]} qedritifydtmynntrmmadaiaqgiaetdprvavkifnvarsdkneiltnvfrskgvl vgtstmnnvmmpkiaglveemtglrfrnkrasafgshgwsggavdrlstrlqdagfemsl slkakwrpdqdalklcrehgreiarqwalapl
Timeline for d6etbb2: