Lineage for d1hn9b1 (1hn9 B:1001-1174)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1392123Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 1392124Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 1392579Family c.95.1.2: Chalcone synthase-like [53914] (9 proteins)
  6. 1392707Protein Ketoacyl-ACP synthase III (FabH) [53912] (3 species)
  7. 1392708Species Escherichia coli [TaxId:562] [53913] (9 PDB entries)
  8. 1392719Domain d1hn9b1: 1hn9 B:1001-1174 [35979]
    complexed with po4

Details for d1hn9b1

PDB Entry: 1hn9 (more details), 2 Å

PDB Description: crystal structure of beta-ketoacyl-acp synthase iii
PDB Compounds: (B:) beta-ketoacyl-acyl carrier protein synthase III

SCOPe Domain Sequences for d1hn9b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hn9b1 c.95.1.2 (B:1001-1174) Ketoacyl-ACP synthase III (FabH) {Escherichia coli [TaxId: 562]}
mytkiigtgsylpeqvrtnadlekmvdtsdewivtrtgirerhiaapnetvstmgfeaat
raiemagiekdqiglivvattsathafpsaacqiqsmlgikgcpafdvaaacagftyals
vadqyvksgavkyalvvgsdvlartcdptdrgtiiifgdgagaavlaaseepgi

SCOPe Domain Coordinates for d1hn9b1:

Click to download the PDB-style file with coordinates for d1hn9b1.
(The format of our PDB-style files is described here.)

Timeline for d1hn9b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hn9b2