SCOPe 2.07: Domain d6bgeb_: 6bge B:

Lineage for d6bgeb_ (6bge B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (21 proteins)
   core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest

6. Protein automated matches [190393] (13 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:210] [359660] (1 PDB entry)

8. Domain d6bgeb_: 6bge B: [359699]
   automated match to d1g6oa_
   complexed with dn7, epe, gol, so4

Details for d6bgeb_

PDB Entry: 6bge, 2.9 Å

PDB Description: helicobacter pylori atpase, hp0525, in complex with 1g4 compound

PDB Compounds: (B:) VirB11-like protein

SCOPe Domain Sequences for d6bgeb_:

Sequence; same for both SEQRES and ATOM records:

>d6bgeb_ c.37.1.11 (B:) automated matches {Helicobacter pylori [TaxId: 210]}
lsaedkkfleveralkeaalnplrhateelfgdflkmeniteicyngnkvvwvlknngew
qpfdvrdrkafslsrlmhfarccasfkkktidnyenpilssnlangervqivlspvtvnd
etisisiripskttyphsffeeqgfynlldnkeqaisaikdgiaigknvivcggtgsgkt
tyiksimefipkeeriisiedteeivfkhhknytqlffggnitsadclksclrmrpdrii
lgelrsseaydfynvlcsghkgtlttlhagsseeafirlanmsssnsaarnikfeslieg
fkdlidmivhinhhkqcdefyik

Timeline for d6bgeb_:

• d6bgeb_ is new in SCOPe 2.07-stable
  
• d6bgeb_ appears in the current release, SCOPe 2.08