SCOPe 2.08: Domain d6mu3m1: 6mu3 M:1-115

Lineage for d6mu3m1 (6mu3 M:1-115)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Engineered (including hybrid species) [88562] (67 PDB entries)
   SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # humanized antibody ! SQ NA # Humanized antibody ! SQ NA # engineered antibody

8. Domain d6mu3m1: 6mu3 M:1-115 [359665]
   Other proteins in same PDB: d6mu3h2, d6mu3k1, d6mu3k2, d6mu3l1, d6mu3l2, d6mu3m2
   automated match to d1op3h1
   complexed with bma, man

Details for d6mu3m1

PDB Entry: 6mu3, 2.33 Å

PDB Description: anti-hiv-1 fab 2g12 + man7 re-refinement

PDB Compounds: (M:) FAB 2G12, heavy chain

SCOPe Domain Sequences for d6mu3m1:

Sequence; same for both SEQRES and ATOM records:

>d6mu3m1 b.1.1.1 (M:1-115) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)}
evqlvesggglvkaggslilscgvsnfrisahtmnwvrrvpggglewvasistsstyrdy
adavkgrftvsrddledfvylqmhkmrvedtaiyycarkgsdrlsdndpfdawgpgtvvt
vspas

Timeline for d6mu3m1:

• d6mu3m1 first appeared in SCOPe 2.07