Lineage for d1kas_1 (1kas 2-251)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 186537Fold c.95: Thiolase-like [53900] (1 superfamily)
  4. 186538Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. 186539Family c.95.1.1: Thiolase-related [53902] (5 proteins)
  6. 186590Protein Beta-ketoacyl-ACP synthase II [53909] (2 species)
  7. 186591Species Escherichia coli [TaxId:562] [53910] (2 PDB entries)
  8. 186592Domain d1kas_1: 1kas 2-251 [35964]

Details for d1kas_1

PDB Entry: 1kas (more details), 2.4 Å

PDB Description: beta-ketoacyl-acp synthase ii from escherichia coli

SCOP Domain Sequences for d1kas_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kas_1 c.95.1.1 (2-251) Beta-ketoacyl-ACP synthase II {Escherichia coli}
krrvvvtglgmlspvgntvestwkallagqsgislidhfdtsayatkfaglvkdfncedi
isrkeqrkmdafiqygivagvqamqdsgleiteenatrigaaigsgigglglieenhtsl
mnggprkispffvpstivnmvaghltimyglrgpsisiatactsgvhnighaariiaygd
advmvaggaekastplgvggfgaaralstrndnpqaasrpwdkerdgfvlgdgagmlvle
eyehakkrga

SCOP Domain Coordinates for d1kas_1:

Click to download the PDB-style file with coordinates for d1kas_1.
(The format of our PDB-style files is described here.)

Timeline for d1kas_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kas_2