Lineage for d6bfzc2 (6bfz C:140-431)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2445369Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2445370Family c.1.11.1: Enolase [51605] (2 proteins)
    automatically mapped to Pfam PF00113
  6. 2445478Protein automated matches [226973] (8 species)
    not a true protein
  7. 2445484Species Escherichia coli [TaxId:562] [359500] (3 PDB entries)
  8. 2445493Domain d6bfzc2: 6bfz C:140-431 [359634]
    Other proteins in same PDB: d6bfza1, d6bfza3, d6bfzb1, d6bfzb3, d6bfzc1, d6bfzc3, d6bfzd1, d6bfzd3, d6bfze1, d6bfze3, d6bfzf1, d6bfzf3
    automated match to d2fymc1
    complexed with 2pg, gol, mes, mg, pep, so4

Details for d6bfzc2

PDB Entry: 6bfz (more details), 2.21 Å

PDB Description: crystal structure of enolase from e. coli with a mixture of apo form, substrate, and product form
PDB Compounds: (C:) enolase

SCOPe Domain Sequences for d6bfzc2:

Sequence, based on SEQRES records: (download)

>d6bfzc2 c.1.11.1 (C:140-431) automated matches {Escherichia coli [TaxId: 562]}
pgkysmpvpmmniinggehadnnvdiqefmiqpvgaktvkeairmgsevfhhlakvlkak
gmntavgdeggyapnlgsnaealaviaeavkaagyelgkditlamdcaasefykdgkyvl
agegnkaftseefthfleeltkqypivsiedgldesdwdgfayqtkvlgdkiqlvgddlf
vtntkilkegiekgiansilikfnqigsltetlaaikmakdagytavishrsgetedati
adlavgtaagqiktgsmsrsdrvakynqlirieealgekapyngrkeikgqa

Sequence, based on observed residues (ATOM records): (download)

>d6bfzc2 c.1.11.1 (C:140-431) automated matches {Escherichia coli [TaxId: 562]}
pgkysmpvpmmniinggdnvdiqefmiqpvgaktvkeairmgsevfhhlakvlkakgmnt
avgdeggyapnlgsnaealaviaeavkaagyelgkditlamdcaasefykdgkyvlafts
eefthfleeltkqypivsiedgldesdwdgfayqtkvlgdkiqlvgddlfvtntkilkeg
iekgiansilikfnqigsltetlaaikmakdagytavishrsgetedatiadlavgtaag
qiktgsmsrsdrvakynqlirieealgekapyngrkeikgqa

SCOPe Domain Coordinates for d6bfzc2:

Click to download the PDB-style file with coordinates for d6bfzc2.
(The format of our PDB-style files is described here.)

Timeline for d6bfzc2: