SCOPe 2.08: Domain d6epkd1: 6epk D:1-295

Lineage for d6epkd1 (6epk D:1-295)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily)
   2 intertwined domains; all-beta and alpha+beta

4. Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families)

5. Family f.10.1.0: automated matches [227258] (1 protein)
   not a true family

6. Protein automated matches [227047] (11 species)
   not a true protein

7. Species Yellow fever virus [TaxId:11089] [359531] (3 PDB entries)

8. Domain d6epkd1: 6epk D:1-295 [359532]
   Other proteins in same PDB: d6epka2, d6epka3, d6epkd2, d6epkd3
   automated match to d2i69a1
   complexed with gol, so4

Details for d6epkd1

PDB Entry: 6epk, 2.7 Å

PDB Description: crystal structure of the precursor membrane protein-envelope protein heterodimer from the yellow fever virus

PDB Compounds: (D:) Envelope protein E

SCOPe Domain Sequences for d6epkd1:

Sequence; same for both SEQRES and ATOM records:

>d6epkd1 f.10.1.0 (D:1-295) automated matches {Yellow fever virus [TaxId: 11089]}
ahcigitdrdfiegvhggtwvsatleqdkcvtvmapdkpsldisletvaidgpaearkvc
ynavlthvkindkcpstgeahlaeenegdnackrtysdrgwgngcglfgkgsivacakft
caksmslfevdqtkiqyviraqlhvgakqenwntdiktlkfdalsgsqeaeftgygkatl
ecqvqtavdfgnsyiaemekeswivdrqwaqdltlpwqsgsggvwremhhlvefepphaa
tirvlalgnqegslktaltgamrvtkdtndnnlyklhgghvscrvklsaltlkgt

Timeline for d6epkd1:

• d6epkd1 first appeared in SCOPe 2.07