Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily) 2 intertwined domains; all-beta and alpha+beta |
Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families) |
Family f.10.1.0: automated matches [227258] (1 protein) not a true family |
Protein automated matches [227047] (11 species) not a true protein |
Species Yellow fever virus [TaxId:11089] [359531] (3 PDB entries) |
Domain d6epkd1: 6epk D:1-295 [359532] Other proteins in same PDB: d6epka2, d6epka3, d6epkd2, d6epkd3 automated match to d2i69a1 complexed with gol, so4 |
PDB Entry: 6epk (more details), 2.7 Å
SCOPe Domain Sequences for d6epkd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6epkd1 f.10.1.0 (D:1-295) automated matches {Yellow fever virus [TaxId: 11089]} ahcigitdrdfiegvhggtwvsatleqdkcvtvmapdkpsldisletvaidgpaearkvc ynavlthvkindkcpstgeahlaeenegdnackrtysdrgwgngcglfgkgsivacakft caksmslfevdqtkiqyviraqlhvgakqenwntdiktlkfdalsgsqeaeftgygkatl ecqvqtavdfgnsyiaemekeswivdrqwaqdltlpwqsgsggvwremhhlvefepphaa tirvlalgnqegslktaltgamrvtkdtndnnlyklhgghvscrvklsaltlkgt
Timeline for d6epkd1: