Lineage for d6e7dg1 (6e7d G:77-194)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2607278Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2607279Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2608201Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2608202Protein automated matches [190159] (20 species)
    not a true protein
  7. 2608590Species Mouse (Mus musculus) [TaxId:10090] [187331] (29 PDB entries)
  8. 2608657Domain d6e7dg1: 6e7d G:77-194 [359429]
    Other proteins in same PDB: d6e7da2, d6e7dc2, d6e7dd2, d6e7dg2, d6e7di2, d6e7dk2, d6e7dm2, d6e7do2
    automated match to d3rs1a_
    complexed with nag, so4

Details for d6e7dg1

PDB Entry: 6e7d (more details), 2.9 Å

PDB Description: structure of the inhibitory nkr-p1b receptor bound to the host-encoded ligand, clr-b
PDB Compounds: (G:) C-type lectin domain family 2 member D

SCOPe Domain Sequences for d6e7dg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6e7dg1 d.169.1.0 (G:77-194) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
yaacpqnwigvenkcfyfseypsnwtfaqafcmaqeaqlarfdnqdelnflmrykanfds
wiglhressehpwkwtdnteynntipirgeerfaylnnngisstriyslrmwicskln

SCOPe Domain Coordinates for d6e7dg1:

Click to download the PDB-style file with coordinates for d6e7dg1.
(The format of our PDB-style files is described here.)

Timeline for d6e7dg1: