SCOPe 2.07: Domain d5zi3b2: 5zi3 B:145-339

Lineage for d5zi3b2 (5zi3 B:145-339)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.0: automated matches [227146] (1 protein)
   not a true family

6. Protein automated matches [226850] (47 species)
   not a true protein

7. Species Saccharomyces cerevisiae [TaxId:4932] [359404] (3 PDB entries)

8. Domain d5zi3b2: 5zi3 B:145-339 [359405]
   Other proteins in same PDB: d5zi3a1, d5zi3b1
   automated match to d1ib6a2
   complexed with gol

Details for d5zi3b2

PDB Entry: 5zi3, 2.1 Å

PDB Description: mdh3 wild type, apo-form

PDB Compounds: (B:) malate dehydrogenase

SCOPe Domain Sequences for d5zi3b2:

Sequence; same for both SEQRES and ATOM records:

>d5zi3b2 d.162.1.0 (B:145-339) automated matches {Saccharomyces cerevisiae [TaxId: 4932]}
vtnldlvraetflvdylmlknpkigqeqdkttmhrkvtvigghsgetiipiitdkslvfq
ldkqyehfihrvqfggdeivkakqgagsatlsmafagakfaeevlrsfhnekpeteslsa
fvylpglkngkkaqqlvgdnsieyfslpivlrngsvvsidtsvleklspreeqlvntavk
elrkniekgksfild

Timeline for d5zi3b2:

• d5zi3b2 is new in SCOPe 2.07-stable
  
• d5zi3b2 appears in the current release, SCOPe 2.08