Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.7: LysM domain [54105] (1 superfamily) beta-alpha(2)-beta; antiparallel strands |
Superfamily d.7.1: LysM domain [54106] (2 families) automatically mapped to Pfam PF01476 |
Family d.7.1.0: automated matches [234000] (1 protein) not a true family |
Protein automated matches [234001] (6 species) not a true protein |
Species Pteris ryukyuensis [TaxId:367335] [346349] (2 PDB entries) |
Domain d5ylgd_: 5ylg D: [359380] automated match to d4pxvc_ complexed with edo, zn |
PDB Entry: 5ylg (more details), 1.48 Å
SCOPe Domain Sequences for d5ylgd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ylgd_ d.7.1.0 (D:) automated matches {Pteris ryukyuensis [TaxId: 367335]} cttytiksgdtcyaisqargislsdfeswnagidcnnlqigqvvcvsk
Timeline for d5ylgd_: