Lineage for d5ylgd_ (5ylg D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2535978Fold d.7: LysM domain [54105] (1 superfamily)
    beta-alpha(2)-beta; antiparallel strands
  4. 2535979Superfamily d.7.1: LysM domain [54106] (2 families) (S)
    automatically mapped to Pfam PF01476
  5. 2535988Family d.7.1.0: automated matches [234000] (1 protein)
    not a true family
  6. 2535989Protein automated matches [234001] (6 species)
    not a true protein
  7. 2536008Species Pteris ryukyuensis [TaxId:367335] [346349] (2 PDB entries)
  8. 2536012Domain d5ylgd_: 5ylg D: [359380]
    automated match to d4pxvc_
    complexed with edo, zn

Details for d5ylgd_

PDB Entry: 5ylg (more details), 1.48 Å

PDB Description: crystal structure of lysm domain from pteris ryukyuensis chitinase a
PDB Compounds: (D:) chitinase a

SCOPe Domain Sequences for d5ylgd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ylgd_ d.7.1.0 (D:) automated matches {Pteris ryukyuensis [TaxId: 367335]}
cttytiksgdtcyaisqargislsdfeswnagidcnnlqigqvvcvsk

SCOPe Domain Coordinates for d5ylgd_:

Click to download the PDB-style file with coordinates for d5ylgd_.
(The format of our PDB-style files is described here.)

Timeline for d5ylgd_: