SCOPe 2.07: Domain d5t2qb2: 5t2q B:64-107

Lineage for d5t2qb2 (5t2q B:64-107)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.24: TNF receptor-like [57585] (1 superfamily)
   duplication: consists of three similar disulfide-rich domains

4. Superfamily g.24.1: TNF receptor-like [57586] (3 families)

5. Family g.24.1.1: TNF receptor-like [57587] (6 proteins)
   Pfam PF00020; TNFR/NGFR cysteine-rich region

6. Protein automated matches [227085] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226417] (4 PDB entries)

8. Domain d5t2qb2: 5t2q B:64-107 [359358]
   automated match to d4rsul2

Details for d5t2qb2

PDB Entry: 5t2q, 1.9 Å

PDB Description: unliganded human hvem at 1.9a in p 1 21 1

PDB Compounds: (B:) Tumor necrosis factor receptor superfamily member 14

SCOPe Domain Sequences for d5t2qb2:

Sequence; same for both SEQRES and ATOM records:

>d5t2qb2 g.24.1.1 (B:64-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mcdpamglrasrncsrtenavcgcspghfcivqdgdhcaacray

Timeline for d5t2qb2:

• d5t2qb2 is new in SCOPe 2.07-stable
  
• d5t2qb2 appears in the current release, SCOPe 2.08