Lineage for d6fd9a_ (6fd9 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520986Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2520987Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2522523Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2522524Protein automated matches [190039] (158 species)
    not a true protein
  7. 2523415Species Psychrobacter arcticus [TaxId:259536] [338566] (12 PDB entries)
  8. 2523421Domain d6fd9a_: 6fd9 A: [359249]
    automated match to d5m8hf_
    complexed with amp

Details for d6fd9a_

PDB Entry: 6fd9 (more details), 2.2 Å

PDB Description: catalytic subunit hisg from psychrobacter arcticus atp phosphoribosyltransferase (hiszg atpprt) in complex with amp
PDB Compounds: (A:) ATP phosphoribosyltransferase

SCOPe Domain Sequences for d6fd9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fd9a_ c.94.1.0 (A:) automated matches {Psychrobacter arcticus [TaxId: 259536]}
flgltlalskgrileetmpllraagvelledpeasrklifptsnpnvrvlilrasdvpty
vehgaadfgvagkdvllehganhvyelldlkiaqcklmtagvkdaplpnrrlriatkyvn
varayfasqgqqvdviklygsmelaplvglgdlivdvvdtgntlrangleardhicdvss
rlivnqvsykrkfallepildsfknsins

SCOPe Domain Coordinates for d6fd9a_:

Click to download the PDB-style file with coordinates for d6fd9a_.
(The format of our PDB-style files is described here.)

Timeline for d6fd9a_: