SCOPe 2.07: Domain d6gxta_: 6gxt A:

Lineage for d6gxta_ (6gxt A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (124 species)
   not a true protein

7. Species Rhodopseudomonas palustris [TaxId:258594] [329218] (38 PDB entries)

8. Domain d6gxta_: 6gxt A: [359065]
   automated match to d5k3ba_
   complexed with fah

Details for d6gxta_

PDB Entry: 6gxt, 1.95 Å

PDB Description: the hit-and-return system enables efficient time-resolved serial synchrotron crystallography: facd2052ms after reaction initiation

PDB Compounds: (A:) Fluoroacetate Dehalogenase

SCOPe Domain Sequences for d6gxta_:

Sequence; same for both SEQRES and ATOM records:

>d6gxta_ c.69.1.0 (A:) automated matches {Rhodopseudomonas palustris [TaxId: 258594]}
ladlfpgfgsewintssgrifarvggdgppllllhgfpqthvmwhrvapklaerfkviva
dlpgygwsdmpesdeqhtpytkramakqlieameqlghvhfalaghdrgarvsyrlalds
pgrlsklavldilptyeywqrmnrayalkiyhwsflaqpaplpenllggdpdfyvkakla
swtragdlsafdpravehyriafadpmrrhvmcedyragayadfehdkidveagnkipvp
mlalwgasgiaqsaatpldvwrkwasdvqgapiesghflpeeapdqtaealvrffsaa

Timeline for d6gxta_:

• d6gxta_ is new in SCOPe 2.07-stable
  
• d6gxta_ appears in the current release, SCOPe 2.08