Class a: All alpha proteins [46456] (289 folds) |
Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily) multihelical; consists of two all-alpha domains |
Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) |
Family a.93.1.0: automated matches [191605] (1 protein) not a true family |
Protein automated matches [191104] (14 species) not a true protein |
Species Burkholderia pseudomallei [TaxId:28450] [350213] (4 PDB entries) |
Domain d6mpyb2: 6mpy B:441-747 [359043] automated match to d2ccda2 complexed with cl, hem, mpd, na, oxy, po4 |
PDB Entry: 6mpy (more details), 2 Å
SCOPe Domain Sequences for d6mpyb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6mpyb2 a.93.1.0 (B:441-747) automated matches {Burkholderia pseudomallei [TaxId: 28450]} aevllwqdpipavdhplidaadaaelkakvlasgltvsqlvstawaaastfrgsdkrgga ngarirlapqkdweanqpeqlaavletleairtafngaqrggkqvsladlivlagcagve qaaknaghavtvpfapgradasqeqtdvesmavlepvadgfrnylkgkyrvpaevllvdk aqlltlsapemtvllgglrvlganvgqsrhgvftareqaltndffvnlldmgtewkptaa dadvfegrdratgelkwtgtrvdlvfgshsqlralaevygsadaqekfvrdfvavwnkvm nldrfdl
Timeline for d6mpyb2: