Lineage for d6fzda1 (6fzd A:4-389)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2507025Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2507026Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2508522Family c.69.1.18: Bacterial lipase [53570] (4 proteins)
    lack the first two strands of the common fold
  6. 2508604Protein automated matches [190277] (13 species)
    not a true protein
  7. 2508629Species Geobacillus stearothermophilus [TaxId:1422] [226739] (12 PDB entries)
  8. 2508635Domain d6fzda1: 6fzd A:4-389 [358946]
    Other proteins in same PDB: d6fzda2
    automated match to d4fkba_
    complexed with ca, zn

Details for d6fzda1

PDB Entry: 6fzd (more details), 1.8 Å

PDB Description: crystal structure of lipase from geobacillus stearothermophilus t6 variant l184f/a187f/l360f
PDB Compounds: (A:) Lipase

SCOPe Domain Sequences for d6fzda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fzda1 c.69.1.18 (A:4-389) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
srandapivllhgftgwgreemfgfkywggvrgdieqwlndngyrtytlavgplssnwdr
aceayaqlvggtvdygaahaakhgharfgrtypgllpelkrggrihiiahsqggqtarml
vsllengsqeereyakahnvslsplfegghhfvlsvttiatphdgttlvnmvdftdrffd
fqkfvlkaaavasnvpytsqvydfkldqwglrrqpgesfdqyferlkrspvwtstdtary
dlsvpgaeklnqwvkaspntyylsfatertyrgaltgnyypelgmnafsavvcapflgsy
rnatlgiddrwlendgivnafsmngpkrgstdrivpydgtikkgvwndmgtynvdhfevi
gvdpnplfdirafylrlaeqlaslqp

SCOPe Domain Coordinates for d6fzda1:

Click to download the PDB-style file with coordinates for d6fzda1.
(The format of our PDB-style files is described here.)

Timeline for d6fzda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6fzda2