Lineage for d6dssb_ (6dss B:)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) 
Family c.1.2.3: Decarboxylase [51375] (4 proteins) 
Protein Protozoan orotidine monophosphate decarboxylase [141749] (5 species) 
Species Plasmodium falciparum (isolate 3D7) (Plasmodium falciparum 3D7) [TaxId:36329] [159376] (8 PDB entries) 
Domain d6dssb_: 6dss B: [358892]
automated match to d2f84a1
complexed with u5p
Details for d6dssb_
PDB Entry: 6dss (more details), 2.6 Å
PDB Description: re-refinement of p. falciparum orotidine 5'-monophosphate decarboxylase
PDB Compounds: (B:) orotidine 5'-monophosphate decarboxylaseSCOPe Domain Sequences for d6dssb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6dssb_ c.1.2.3 (B:) Protozoan orotidine monophosphate decarboxylase {Plasmodium falciparum (isolate 3D7) (Plasmodium falciparum 3D7) [TaxId: 36329]}
gfkvklekrrnaintclcigldpdekdienfmknekennynnikknlkekyinnvsikkd
illkapdniireekseeffyffnhfcfyiinetnkyaltfkmnfafyipygsvgidvlkn
vfdylyelniptildmkindigntvknyrkfifeylksdsctvniymgtnmlkdicydee
knkyysafvlvkttnpdsaifqknlsldnkqayvimaqealnmssylnleqnnefigfvv
gansydemnyirtyfpncyilspgigaqngdlhktltngyhksyekilinigraitknpy
pqkaaqmyydqinailkq
SCOPe Domain Coordinates for d6dssb_:
Click to download the PDB-style file with coordinates for d6dssb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d6dssb_:
- d6dssb_ is new in SCOPe 2.07-stable
- d6dssb_ appears in the current release, SCOPe 2.08
View in 3D
