SCOPe 2.07: Domain d6d3fa_: 6d3f A:

Lineage for d6d3fa_ (6d3f A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.0: automated matches [191381] (1 protein)
   not a true family

6. Protein automated matches [190475] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187400] (140 PDB entries)

8. Domain d6d3fa_: 6d3f A: [358824]
   automated match to d3b7oa_

Details for d6d3fa_

PDB Entry: 6d3f, 2.27 Å

PDB Description: crystal structure of the ptp epsilon d2 domain

PDB Compounds: (A:) receptor-type tyrosine-protein phosphatase epsilon

SCOPe Domain Sequences for d6d3fa_:

Sequence; same for both SEQRES and ATOM records:

>d6d3fa_ c.45.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gleeefrkltnvrimkenmrtgnlpanmkkarviqiipydfnrvilsmkrgqeytdyina
sfidgyrqkdyfiatqgplahtvedfwrmiwewkshtivmltevqereqdkcyqywpteg
svthgeitieikndtlseaisirdflvtlnqpqarqeeqvrvvrqfhfhgwpeigipaeg
kgmidliaavqkqqqqtgnhpitvhcsagagrtgtfialsnilervkaeglldvfqavks
lrlqrphmvqtleqyefcykvvqdfidifsdyanf

Timeline for d6d3fa_:

• d6d3fa_ is new in SCOPe 2.07-stable
  
• d6d3fa_ appears in the current release, SCOPe 2.08