SCOPe 2.07: Domain d5yunb1: 5yun B:4-112

Lineage for d5yunb1 (5yun B:4-112)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 proteins)
   barrel, closed; n=5, S=10

6. Protein automated matches [190206] (10 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:208964] [358661] (2 PDB entries)

8. Domain d5yunb1: 5yun B:4-112 [358766]
   Other proteins in same PDB: d5yuna2, d5yunb2, d5yunc2
   automated match to d1eygd_
   protein/DNA complex; complexed with myc

Details for d5yunb1

PDB Entry: 5yun, 2.67 Å

PDB Description: crystal structure of ssb complexed with myc

PDB Compounds: (B:) Single-stranded DNA-binding protein

SCOPe Domain Sequences for d5yunb1:

Sequence, based on SEQRES records:

>d5yunb1 b.40.4.3 (B:4-112) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
gvnkvilvgnvggdpetrympngnavtnitlatseswkdkqtgqqqertewhrvvffgrl
aeiageylrkgsqvyvegslrtrkwqgqdgqdrytteivvdingnmqll

Sequence, based on observed residues (ATOM records):

>d5yunb1 b.40.4.3 (B:4-112) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
gvnkvilvgnvggdpetrympngnavtnitlatseswqertewhrvvffgrlaeiageyl
rkgsqvyvegslrtrkwqgqdgqdrytteivvdingnmqll

Timeline for d5yunb1:

• d5yunb1 is new in SCOPe 2.07-stable
  
• d5yunb1 appears in the current release, SCOPe 2.08