Lineage for d6gh7c_ (6gh7 C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2415300Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2415301Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2415302Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 2415640Protein automated matches [190191] (2 species)
    not a true protein
  7. 2415735Species Streptomyces avidinii [TaxId:1895] [189343] (98 PDB entries)
  8. 2415747Domain d6gh7c_: 6gh7 C: [358511]
    automated match to d1n9mc_
    complexed with eyw

Details for d6gh7c_

PDB Entry: 6gh7 (more details), 1.08 Å

PDB Description: wildtype core-streptavidin with a conjugated biotinylated pyrrolidine
PDB Compounds: (C:) streptavidin

SCOPe Domain Sequences for d6gh7c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gh7c_ b.61.1.1 (C:) automated matches {Streptomyces avidinii [TaxId: 1895]}
gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvkp

SCOPe Domain Coordinates for d6gh7c_:

Click to download the PDB-style file with coordinates for d6gh7c_.
(The format of our PDB-style files is described here.)

Timeline for d6gh7c_: