SCOPe 2.07: Domain d6egza_: 6egz A:

Lineage for d6egza_ (6egz A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein Mitochondrial cytochrome c [46642] (7 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (90 PDB entries)
   Uniprot P00044

8. Domain d6egza_: 6egz A: [358482]
   automated match to d5t8wa_
   complexed with b4x, hem, na, so4

Details for d6egza_

PDB Entry: 6egz, 2.17 Å

PDB Description: crystal structure of cytochrome c in complex with di-pegylated sulfonatocalix[4]arene

PDB Compounds: (A:) Cytochrome c iso-1

SCOPe Domain Sequences for d6egza_:

Sequence; same for both SEQRES and ATOM records:

>d6egza_ a.3.1.1 (A:) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
aefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate

Timeline for d6egza_:

• d6egza_ is new in SCOPe 2.07-stable
  
• d6egza_ appears in the current release, SCOPe 2.08