Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) |
Family c.1.1.0: automated matches [191424] (1 protein) not a true family |
Protein automated matches [190605] (25 species) not a true protein |
Species Zea mays [TaxId:4577] [358451] (1 PDB entry) |
Domain d6cg9a_: 6cg9 A: [358452] Other proteins in same PDB: d6cg9b2 automated match to d4mkna_ complexed with act, gol |
PDB Entry: 6cg9 (more details), 1.8 Å
SCOPe Domain Sequences for d6cg9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6cg9a_ c.1.1.0 (A:) automated matches {Zea mays [TaxId: 4577]} grkffvggnwkcngttdqvekivktlnegqvppsdvvevvvsppyvflpvvksqlrqefh vaaqncwvkkggaftgevsaemlvnlgvpwvilghserrallgesnefvgdkvayalsqg lkviacvgetleqreagstmdvvaaqtkaiaekikdwsnvvvayepvwaigtgkvatpaq aqevhaslrdwlktnaspevaestriiyggsvtaanckelaaqpdvdgflvggaslkpef idiinaatv
Timeline for d6cg9a_: