Lineage for d6cg9a_ (6cg9 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2434696Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 2435148Family c.1.1.0: automated matches [191424] (1 protein)
    not a true family
  6. 2435149Protein automated matches [190605] (25 species)
    not a true protein
  7. 2435325Species Zea mays [TaxId:4577] [358451] (1 PDB entry)
  8. 2435326Domain d6cg9a_: 6cg9 A: [358452]
    Other proteins in same PDB: d6cg9b2
    automated match to d4mkna_
    complexed with act, gol

Details for d6cg9a_

PDB Entry: 6cg9 (more details), 1.8 Å

PDB Description: crystal structure of triosephosphate isomerase from zea mays (mexican corn)
PDB Compounds: (A:) Triosephosphate isomerase, cytosolic

SCOPe Domain Sequences for d6cg9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cg9a_ c.1.1.0 (A:) automated matches {Zea mays [TaxId: 4577]}
grkffvggnwkcngttdqvekivktlnegqvppsdvvevvvsppyvflpvvksqlrqefh
vaaqncwvkkggaftgevsaemlvnlgvpwvilghserrallgesnefvgdkvayalsqg
lkviacvgetleqreagstmdvvaaqtkaiaekikdwsnvvvayepvwaigtgkvatpaq
aqevhaslrdwlktnaspevaestriiyggsvtaanckelaaqpdvdgflvggaslkpef
idiinaatv

SCOPe Domain Coordinates for d6cg9a_:

Click to download the PDB-style file with coordinates for d6cg9a_.
(The format of our PDB-style files is described here.)

Timeline for d6cg9a_: