Class b: All beta proteins [48724] (178 folds) |
Fold b.22: TNF-like [49841] (1 superfamily) sandwich, 10 strands in 2 sheets; jelly-roll |
Superfamily b.22.1: TNF-like [49842] (2 families) |
Family b.22.1.0: automated matches [191519] (1 protein) not a true family |
Protein automated matches [190873] (4 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [271469] (9 PDB entries) |
Domain d5ybzc1: 5ybz C:125-255 [358369] Other proteins in same PDB: d5ybza2, d5ybza3, d5ybzc2, d5ybzc3, d5ybzd2, d5ybzd3 automated match to d2wnva_ complexed with ca, cl, dms, na, so4 |
PDB Entry: 5ybz (more details), 1.71 Å
SCOPe Domain Sequences for d5ybzc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ybzc1 b.22.1.0 (C:125-255) automated matches {Mouse (Mus musculus) [TaxId: 10090]} pkiafyaglkrqhegyevlkfddvvtnlgnhydpttgkftcsipgiyfftyhvlmrggdg tsmwadlcknnqvrasaiaqdadqnydyasnsvvlhlepgdevyikldggkahggnnnky stfsgfiiyad
Timeline for d5ybzc1: