Class a: All alpha proteins [46456] (289 folds) |
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) automatically mapped to Pfam PF00081 |
Family a.2.11.0: automated matches [227154] (1 protein) not a true family |
Protein automated matches [226859] (38 species) not a true protein |
Species Sphingobacterium spiritivorum [TaxId:258] [275545] (3 PDB entries) |
Domain d6gsca1: 6gsc A:23-87 [358351] Other proteins in same PDB: d6gsca2, d6gsca3, d6gscb2, d6gscb3 automated match to d4ffka1 complexed with mn |
PDB Entry: 6gsc (more details), 1.32 Å
SCOPe Domain Sequences for d6gsca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6gsca1 a.2.11.0 (A:23-87) automated matches {Sphingobacterium spiritivorum [TaxId: 258]} meihyskhhagytanlnkaiagtpaekesienilakvsqysdavrnnagghynhelfwsi ltpnk
Timeline for d6gsca1: