Lineage for d6hpga_ (6hpg A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338494Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2339718Superfamily a.118.8: TPR-like [48452] (10 families) (S)
  5. 2340047Family a.118.8.0: automated matches [191581] (1 protein)
    not a true family
  6. 2340048Protein automated matches [191037] (12 species)
    not a true protein
  7. 2340101Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [225165] (2 PDB entries)
  8. 2340102Domain d6hpga_: 6hpg A: [358278]
    automated match to d2vyib_

Details for d6hpga_

PDB Entry: 6hpg (more details), 2 Å

PDB Description: arabidopsis om64 tpr domain
PDB Compounds: (A:) Outer envelope protein 64, mitochondrial

SCOPe Domain Sequences for d6hpga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hpga_ a.118.8.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gnmeasevmkekgnaaykgkqwnkavnfyteaiklnganatyycnraaaflelccfqqae
qdctkamlidkknvkaylrrgtareslvrykeaaadfrhalvlepqnktakvaekrlrkh
i

SCOPe Domain Coordinates for d6hpga_:

Click to download the PDB-style file with coordinates for d6hpga_.
(The format of our PDB-style files is described here.)

Timeline for d6hpga_: