SCOPe 2.07: Domain d6b83b_: 6b83 B:

Lineage for d6b83b_ (6b83 B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
   automatically mapped to Pfam PF00068

6. Protein automated matches [190139] (27 species)
   not a true protein

7. Species Bothrops moojeni [TaxId:98334] [188126] (13 PDB entries)

8. Domain d6b83b_: 6b83 B: [358198]
   automated match to d1xxsa_
   complexed with 6na, so4

Details for d6b83b_

PDB Entry: 6b83, 1.7 Å

PDB Description: crystal structure of myotoxin ii from bothrops moojeni complexed to caproic acid

PDB Compounds: (B:) Basic phospholipase A2 homolog 2

SCOPe Domain Sequences for d6b83b_:

Sequence; same for both SEQRES and ATOM records:

>d6b83b_ a.133.1.2 (B:) automated matches {Bothrops moojeni [TaxId: 98334]}
slfelgkmilqetgknpaksygvygcncgvggrgkpkdatdrccyvhkccykkltgcdpk
kdrysyswkdktivcgennsclkelcecdkavaiclrenldtynkkyrynylkpackkad
pc

Timeline for d6b83b_:

• d6b83b_ is new in SCOPe 2.07-stable
  
• d6b83b_ appears in the current release, SCOPe 2.08