SCOPe 2.07: Domain d6a8pb1: 6a8p B:8-145

Lineage for d6a8pb1 (6a8p B:8-145)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.9: Transglutaminase N-terminal domain [81289] (1 protein)

6. Protein Transglutaminase N-terminal domain [49235] (4 species)
   elaborated with many loop insertions in the common fold

7. Species Human (Homo sapiens), tissue isozyme [TaxId:9606] [74844] (5 PDB entries)
   GDP-binding protein

8. Domain d6a8pb1: 6a8p B:8-145 [358168]
   Other proteins in same PDB: d6a8pa2, d6a8pa3, d6a8pa4, d6a8pa5, d6a8pb2, d6a8pb3, d6a8pb4, d6a8pb5, d6a8pc2, d6a8pc3, d6a8pc4
   automated match to d3ly6a1
   complexed with gtp; mutant

Details for d6a8pb1

PDB Entry: 6a8p, 2.54 Å

PDB Description: transglutaminase 2 mutant g224v in complex with gtp

PDB Compounds: (B:) Protein-glutamine gamma-glutamyltransferase 2

SCOPe Domain Sequences for d6a8pb1:

Sequence, based on SEQRES records:

>d6a8pb1 b.1.18.9 (B:8-145) Transglutaminase N-terminal domain {Human (Homo sapiens), tissue isozyme [TaxId: 9606]}
ercdleletngrdhhtadlcreklvvrrgqpfwltlhfegrnyeasvdsltfsvvtgpap
sqeagtkarfplrdaveegdwtatvvdqqdctlslqlttpanapiglyrlsleastgyqg
ssfvlghfillfnawcpa

Sequence, based on observed residues (ATOM records):

>d6a8pb1 b.1.18.9 (B:8-145) Transglutaminase N-terminal domain {Human (Homo sapiens), tissue isozyme [TaxId: 9606]}
ercdleletngrdhhtadlcreklvvrrgqpfwltlhfegrnyeasvdsltfsvvtgpap
sqeagtkarfplrdaveegdwtatvvdqqdctlslqlttpanapiglyrlsleassfvlg
hfillfnawcpa

Timeline for d6a8pb1:

• d6a8pb1 is new in SCOPe 2.07-stable
  
• d6a8pb1 appears in the current release, SCOPe 2.08