Lineage for d6h8sa_ (6h8s A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2483040Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2483041Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2483697Family c.45.1.0: automated matches [191381] (1 protein)
    not a true family
  6. 2483698Protein automated matches [190475] (10 species)
    not a true protein
  7. 2483925Species Mouse (Mus musculus) [TaxId:10090] [193198] (3 PDB entries)
  8. 2483927Domain d6h8sa_: 6h8s A: [358109]
    automated match to d3o4sa_
    complexed with fsz

Details for d6h8sa_

PDB Entry: 6h8s (more details), 1.77 Å

PDB Description: crystal structure of the mouse protein tyrosine phosphatase ptpn5 (step) in complex with compound bi-0314
PDB Compounds: (A:) Tyrosine-protein phosphatase non-receptor type 5

SCOPe Domain Sequences for d6h8sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6h8sa_ c.45.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
saheyllsasrvlraeelhekaldpfllqaeffeipmnfvdpkeydipglvrknryktil
pnphsrvrltspdpedplssyinanyirgysgeekvyiatqgpivstvadfwrmvwqert
piivmitnieemnekcteywpeeqvvhdgveitvqkvihtedyrlrlislrrgteertlk
hywftswpdqktpdrappllhlvreveeaaqqegphcspiivhcsagigrtgcfiatsic
cqqlrregvvdilkttcqlrqdrggmiqtceqyqfvhhamslyekqlshqs

SCOPe Domain Coordinates for d6h8sa_:

Click to download the PDB-style file with coordinates for d6h8sa_.
(The format of our PDB-style files is described here.)

Timeline for d6h8sa_: