Lineage for d6ciud_ (6ciu D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2546826Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2546827Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2547682Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2547683Protein automated matches [190526] (25 species)
    not a true protein
  7. 2548066Species Galaxea fascicularis [TaxId:46745] [357997] (2 PDB entries)
  8. 2548070Domain d6ciud_: 6ciu D: [358030]
    automated match to d1xssb_

Details for d6ciud_

PDB Entry: 6ciu (more details), 1.7 Å

PDB Description: structure of a thr-rich interface in an azami green tetramer
PDB Compounds: (D:) Azami-Green

SCOPe Domain Sequences for d6ciud_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ciud_ d.22.1.0 (D:) automated matches {Galaxea fascicularis [TaxId: 46745]}
vikpemkiklcmrgtvnghnfviegegkgnpyegtqildlnvtegaplpfaydilttvfq
ygnraftkypadiqdyfkqtfpegyhwersmtyedqgictatsnismrgdcffyditftg
tnfppngpvmqkktlkwepstekmyvrdgvlkgdvnmallleggghyrcdfkttykakkd
vrlpdyhfvdhrieilkhdkdynkvklyenavarysmlpsq

SCOPe Domain Coordinates for d6ciud_:

Click to download the PDB-style file with coordinates for d6ciud_.
(The format of our PDB-style files is described here.)

Timeline for d6ciud_: