SCOPe 2.07: Domain d6dttb_: 6dtt B:

Lineage for d6dttb_ (6dtt B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (158 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:243274] [187721] (11 PDB entries)

8. Domain d6dttb_: 6dtt B: [357764]
   automated match to d4glia_

Details for d6dttb_

PDB Entry: 6dtt, 1.9 Å

PDB Description: apo t. maritima male2

PDB Compounds: (B:) maltose-binding protein MalE2

SCOPe Domain Sequences for d6dttb_:

Sequence; same for both SEQRES and ATOM records:

>d6dttb_ c.94.1.0 (B:) automated matches {Thermotoga maritima [TaxId: 243274]}
qtkltiwcsekqvdilqklgeefkakygipvevqyvdfgsikskfltaapqgqgadiivg
ahdwvgelavngliepipnfsdlknfydtalkafsyggklygvpyameavaliynkdyvd
svpktmdeliekakqideeyggevrgfiydvanfyfsapfilgyggyvfketpqgldvtd
iglanegavkgaklikrmidegvltpgdnygtmdsmfkeglaamiinglwaiksykdagi
nygvapipelepgvpakpfvgvqgfminakspnkviamefltnfiarketmykiyladpr
lparkdvlelvkdnpdvvaftqsasmgtpmpnvpemapvwsamgdalsiiingqasveda
lkeavekikaqiek

Timeline for d6dttb_:

• d6dttb_ is new in SCOPe 2.07-stable
  
• d6dttb_ appears in the current release, SCOPe 2.08