Lineage for d6gbxa_ (6gbx A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2495627Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2497307Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 2497775Family c.56.5.8: Glutaminyl-peptide cyclotransferase-like [142532] (1 protein)
    part of Pfam PF04389
  6. 2497776Protein Glutaminyl-peptide cyclotransferase, QPCT [142533] (2 species)
    Glutaminyl cyclase
  7. 2497777Species Human (Homo sapiens) [TaxId:9606] [142534] (27 PDB entries)
    Uniprot Q16769 33-361
  8. 2497822Domain d6gbxa_: 6gbx A: [357736]
    automated match to d3pbea_
    complexed with edo, s77, so4, zn

Details for d6gbxa_

PDB Entry: 6gbx (more details), 1.72 Å

PDB Description: crystal structure of human glutaminyl cyclase variant y115e-y117e in complex with sen177
PDB Compounds: (A:) Glutaminyl-peptide cyclotransferase

SCOPe Domain Sequences for d6gbxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gbxa_ c.56.5.8 (A:) Glutaminyl-peptide cyclotransferase, QPCT {Human (Homo sapiens) [TaxId: 9606]}
sawpeeknyhqpailnssalrqiaegtsisemwqndlqpllierypgspgsyaarqhimq
riqrlqadwvleidtflsqtpegersfsniistlnptakrhlvlachydskyfshwnnrv
fvgatdsavpcammlelaraldkkllslktvsdskpdlslqliffdgeeaflhwspqdsl
ygsrhlaakmastphppgargtsqlhgmdllvlldligapnptfpnffpnsarwferlqa
iehelhelgllkdhslegryfqnysyggviqddhipflrrgvpvlhlipspfpevwhtmd
dneenldestidnlnkilqvfvleylhl

SCOPe Domain Coordinates for d6gbxa_:

Click to download the PDB-style file with coordinates for d6gbxa_.
(The format of our PDB-style files is described here.)

Timeline for d6gbxa_: