Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (80 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein cH-p21 Ras protein [52593] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [52594] (155 PDB entries) Uniprot Q6P716 |
Domain d6d5mr1: 6d5m R:1-166 [357730] Other proteins in same PDB: d6d5mr2, d6d5ms_ automated match to d6q21a_ complexed with fw4, gnp, mg |
PDB Entry: 6d5m (more details), 2.08 Å
SCOPe Domain Sequences for d6d5mr1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6d5mr1 c.37.1.8 (R:1-166) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh
Timeline for d6d5mr1: