SCOPe 2.07: Domain d6dznl1: 6dzn L:1-107

Lineage for d6dznl1 (6dzn L:1-107)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d6dznl1: 6dzn L:1-107 [357693]
   Other proteins in same PDB: d6dznl2
   automated match to d1n0xl1
   complexed with ae3, cl, pg4

Details for d6dznl1

PDB Entry: 6dzn, 2.1 Å

PDB Description: pan-ebolavirus human antibody adi-15878 fab

PDB Compounds: (L:) Antibody ADI-15878, light chain

SCOPe Domain Sequences for d6dznl1:

Sequence; same for both SEQRES and ATOM records:

>d6dznl1 b.1.1.0 (L:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divltqspstlsasvgdrvtitcrasqsisswlawyqqkpgeapkllisdasslesgvps
rfsgsgsgteftltisslqpddfatyycqqyysspifgggtkveik

Timeline for d6dznl1:

• d6dznl1 is new in SCOPe 2.07-stable
  
• d6dznl1 appears in the current release, SCOPe 2.08