SCOPe 2.07: Domain d5ycdb_: 5ycd B:

Lineage for d5ycdb_ (5ycd B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein automated matches [190087] (15 species)
   not a true protein

7. Species Poecilia reticulata [TaxId:8081] [357578] (1 PDB entry)

8. Domain d5ycdb_: 5ycd B: [357579]
   automated match to d3adka_
   complexed with ap5, mg

Details for d5ycdb_

PDB Entry: 5ycd, 1.8 Å

PDB Description: crystal structure of poecilia reticulata adenylate kinase

PDB Compounds: (B:) Adenylayte kinase

SCOPe Domain Sequences for d5ycdb_:

Sequence; same for both SEQRES and ATOM records:

>d5ycdb_ c.37.1.1 (B:) automated matches {Poecilia reticulata [TaxId: 8081]}
madkikdakiifvvggpgsgkgtqcekivakygythlssgdllraevasgsergkqlqai
mqkgelvpldtvldmikdamiakadvskgflidgyprevkqgeefekkigkpclllyvda
kaetmvkrllkrgetsgrsddneetikkrldlyykatepviafyegrgivkkvdselavd
dvfgqvskaidal

Timeline for d5ycdb_:

• d5ycdb_ is new in SCOPe 2.07-stable
  
• d5ycdb_ appears in the current release, SCOPe 2.08