Lineage for d6maoa_ (6mao A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2427208Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2427417Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 2427616Family b.85.4.0: automated matches [191644] (1 protein)
    not a true family
  6. 2427617Protein automated matches [191182] (19 species)
    not a true protein
  7. 2427766Species Legionella pneumophila [TaxId:272624] [357083] (2 PDB entries)
  8. 2427768Domain d6maoa_: 6mao A: [357482]
    automated match to d5nz2a_
    complexed with mpd, so4, ump

Details for d6maoa_

PDB Entry: 6mao (more details), 1.95 Å

PDB Description: crystal structure of deoxyuridine 5'-triphosphate nucleotidohydrolase from legionella pneumophila philadelphia 1 in complex with dump (deoxyuridine 5'-monophosphate)
PDB Compounds: (A:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d6maoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6maoa_ b.85.4.0 (A:) automated matches {Legionella pneumophila [TaxId: 272624]}
hqviqlkildsrigdtiplpayatdgsagldlrvcisepmqvapqqtvllptgiaiyiad
pklaavilprsglghkngivlgnlvglidsdyqgelkiscwnrsqehftvnpgdriaqlv
fipvvqasfevvnefte

SCOPe Domain Coordinates for d6maoa_:

Click to download the PDB-style file with coordinates for d6maoa_.
(The format of our PDB-style files is described here.)

Timeline for d6maoa_: