Class b: All beta proteins [48724] (178 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.4: dUTPase-like [51283] (2 families) forms tight trimer through an additional beta-sheet in each subunit subunit beta-sheets are orthogonally packed around the three-fold axis |
Family b.85.4.0: automated matches [191644] (1 protein) not a true family |
Protein automated matches [191182] (19 species) not a true protein |
Species Legionella pneumophila [TaxId:272624] [357083] (2 PDB entries) |
Domain d6maoa_: 6mao A: [357482] automated match to d5nz2a_ complexed with mpd, so4, ump |
PDB Entry: 6mao (more details), 1.95 Å
SCOPe Domain Sequences for d6maoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6maoa_ b.85.4.0 (A:) automated matches {Legionella pneumophila [TaxId: 272624]} hqviqlkildsrigdtiplpayatdgsagldlrvcisepmqvapqqtvllptgiaiyiad pklaavilprsglghkngivlgnlvglidsdyqgelkiscwnrsqehftvnpgdriaqlv fipvvqasfevvnefte
Timeline for d6maoa_: