Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) |
Family d.157.1.0: automated matches [191360] (1 protein) not a true family |
Protein automated matches [190418] (31 species) not a true protein |
Species Novosphingobium pentaromativorans [TaxId:1088721] [357473] (1 PDB entry) |
Domain d6aufb_: 6auf B: [357474] automated match to d4awyb_ complexed with cit, zn |
PDB Entry: 6auf (more details), 2.6 Å
SCOPe Domain Sequences for d6aufb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6aufb_ d.157.1.0 (B:) automated matches {Novosphingobium pentaromativorans [TaxId: 1088721]} pttlatackgldgregwshpappahiygntwyvgtcgiasilvtsddghvlidsgpadaa plvlanirklgfdpadvrwiltshehhdhagsiaelqkatgaqiaavasarqvlesgkps addpqsgliegfppvhvarvlvdgdsvtlgrlaltvretpahspgsaswtwqacdeaftc rmiayadsattisaddyrfsdhpdriarirtglsriaqlpcdilvtphpsasnlfdrlsg kaplvnaqacaaysqaagsyfakrlaeeageaa
Timeline for d6aufb_: