Lineage for d6aysa1 (6ays A:1-228)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2495627Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2495644Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2496659Family c.56.2.0: automated matches [191488] (1 protein)
    not a true family
  6. 2496660Protein automated matches [190781] (45 species)
    not a true protein
  7. 2496780Species Campylobacter jejuni [TaxId:197] [357249] (6 PDB entries)
  8. 2496787Domain d6aysa1: 6ays A:1-228 [357468]
    Other proteins in same PDB: d6aysa2, d6aysb2, d6aysc2, d6aysd2, d6ayse2, d6aysf2, d6aysg2, d6aysh2
    automated match to d4p54a_
    complexed with edo, ht6

Details for d6aysa1

PDB Entry: 6ays (more details), 1.7 Å

PDB Description: crystal structure of campylobacter jejuni 5'-methylthioadenosine/s- adenosyl homocysteine nucleosidase (mtan) complexed with hexylthio- dadme-immucillin-a
PDB Compounds: (A:) 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

SCOPe Domain Sequences for d6aysa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6aysa1 c.56.2.0 (A:1-228) automated matches {Campylobacter jejuni [TaxId: 197]}
mkiailgamseeitplletlkdytkiehanntyyfakykdhelvlayskigkvnstlsas
vmiekfgaqvllftgvagafnpeleigdllyatklaqydlditafghplgfvpgneifik
tdeklnnlalevakelniklragiiatgdeficdeakkakireifnadacemegasvalv
cdalkvpcfilramsdkagekaefdfdefvinsakisanfvlkmcekl

SCOPe Domain Coordinates for d6aysa1:

Click to download the PDB-style file with coordinates for d6aysa1.
(The format of our PDB-style files is described here.)

Timeline for d6aysa1: