Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.14: Fumble-like [159623] (4 proteins) Pfam PF03630; type II pantothenate kinase-like |
Protein automated matches [259360] (2 species) not a true protein |
Species Staphylococcus aureus [TaxId:1280] [357241] (6 PDB entries) |
Domain d6awhd_: 6awh D: [357330] automated match to d4nb4a_ complexed with atp, mg, n7g |
PDB Entry: 6awh (more details), 1.9 Å
SCOPe Domain Sequences for d6awhd_:
Sequence, based on SEQRES records: (download)
>d6awhd_ c.55.1.14 (D:) automated matches {Staphylococcus aureus [TaxId: 1280]} mkvgidaggtlikivqeqdnqrtfkteltknidqvvewlnqqqieklcltggnagviaen inipaqifvefdaasqglgillkeqghdladyifanvgtgtslhyfdgqsqrrvggigtg ggmiqglgyllsqitdykqltdmaqhgdrntidlkvrhiykdteppipgdltaanfghvl hhldadftpsnklaavigvvgevvttmaitvarefktenivyigssfhnnallrkvvedy tvlrgckpyyvengafsgaigalyl
>d6awhd_ c.55.1.14 (D:) automated matches {Staphylococcus aureus [TaxId: 1280]} mkvgidaggtlikivqeqdqrtfkteltknidqvvewlnqqqieklcltggnagviaeni nipaqifvefdaasqglgillkeqghdladyifanvgtgtslhyfdgqsqrrvggigtgg gmiqglgyllsqitdykqltdmaqhgdrntidlkvrhiykdteppipgdltaanfghvlh hldadftpsnklaavigvvgevvttmaitvarefktenivyigssfhnnallrkvvedyt vlrgckpyyvengafsgaigalyl
Timeline for d6awhd_: