SCOPe 2.07: Domain d6athb1: 6ath B:173-309

Lineage for d6athb1 (6ath B:173-309)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [47958] (11 PDB entries)

8. Domain d6athb1: 6ath B:173-309 [357273]
   Other proteins in same PDB: d6atha_
   automated match to d3ddqb1
   complexed with so4

Details for d6athb1

PDB Entry: 6ath, 1.82 Å

PDB Description: cdk2/cyclin a/p27-kid-deltac

PDB Compounds: (B:) Cyclin-A2

SCOPe Domain Sequences for d6athb1:

Sequence; same for both SEQRES and ATOM records:

>d6athb1 a.74.1.1 (B:173-309) Cyclin A {Cow (Bos taurus) [TaxId: 9913]}
nevpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetl
hlavnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvl
rmehlvlkvltfdlaap

Timeline for d6athb1:

• d6athb1 is new in SCOPe 2.07-stable
  
• d6athb1 appears in the current release, SCOPe 2.08