Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily) 12 transmembrane helices in an approximate threefold rotational symmetric arrangement |
Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) |
Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins) the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3 |
Protein Mitochondrial cytochrome c oxidase, subunit I [81433] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [81432] (40 PDB entries) |
Domain d5z85n_: 5z85 N: [357126] Other proteins in same PDB: d5z85b1, d5z85b2, d5z85c_, d5z85d_, d5z85e_, d5z85f_, d5z85g_, d5z85h_, d5z85i_, d5z85j_, d5z85k_, d5z85l_, d5z85m_, d5z85o1, d5z85o2, d5z85p_, d5z85q_, d5z85r_, d5z85s_, d5z85t_, d5z85u_, d5z85v_, d5z85w_, d5z85x_, d5z85y_, d5z85z_ automated match to d1v54a_ complexed with azi, cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 5z85 (more details), 1.85 Å
SCOPe Domain Sequences for d5z85n_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5z85n_ f.24.1.1 (N:) Mitochondrial cytochrome c oxidase, subunit I {Cow (Bos taurus) [TaxId: 9913]} mfinrwlfstnhkdigtlyllfgawagmvgtalslliraelgqpgtllgddqiynvvvta hafvmiffmvmpimiggfgnwlvplmigapdmafprmnnmsfwllppsfllllassmvea gagtgwtvypplagnlahagasvdltifslhlagvssilgainfittiinmkppamsqyq tplfvwsvmitavllllslpvlaagitmlltdrnlnttffdpagggdpilyqhlfwffgh pevyililpgfgmishivtyysgkkepfgymgmvwammsigflgfivwahhmftvgmdvd trayftsatmiiaiptgvkvfswlatlhggnikwspammwalgfiflftvggltgivlan ssldivlhdtyyvvahfhyvlsmgavfaimggfvhwfplfsgytlndtwakihfaimfvg vnmtffpqhflglsgmprrysdypdaytmwntissmgsfisltavmlmvfiiweafaskr evltvdltttnlewlngcpppyhtfeeptyvnlk
Timeline for d5z85n_:
View in 3D Domains from other chains: (mouse over for more information) d5z85a_, d5z85b1, d5z85b2, d5z85c_, d5z85d_, d5z85e_, d5z85f_, d5z85g_, d5z85h_, d5z85i_, d5z85j_, d5z85k_, d5z85l_, d5z85m_, d5z85o1, d5z85o2, d5z85p_, d5z85q_, d5z85r_, d5z85s_, d5z85t_, d5z85u_, d5z85v_, d5z85w_, d5z85x_, d5z85y_, d5z85z_ |