SCOPe 2.07: Domain d6d2ma1: 6d2m A:4-211

Lineage for d6d2ma1 (6d2m A:4-211)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.53: Resolvase-like [53040] (2 superfamilies)
   Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest

4. Superfamily c.53.2: beta-carbonic anhydrase, cab [53056] (2 families)

5. Family c.53.2.0: automated matches [191506] (1 protein)
   not a true family

6. Protein automated matches [190830] (14 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [278536] (6 PDB entries)

8. Domain d6d2ma1: 6d2m A:4-211 [357001]
   Other proteins in same PDB: d6d2ma2
   automated match to d5jj8a_
   complexed with imd, zn

Details for d6d2ma1

PDB Entry: 6d2m, 1.9 Å

PDB Description: beta carbonic anhydrase in complex with thiocyanate

PDB Compounds: (A:) carbonic anhydrase

SCOPe Domain Sequences for d6d2ma1:

Sequence; same for both SEQRES and ATOM records:

>d6d2ma1 c.53.2.0 (A:4-211) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
lqqlfennvrwaeaikqedpdffaklarqqtpeylwigcsdarvpaneivgmlpgdlfvh
rnvanvvlhtdlnclsviqfavdvlkvkhilvtghygcggvraslhndqlglidgwlrsi
rdlayeyrehleqlpteeervdrlcelnviqqvanvshtsivqnawhrgqslsvhgciyg
ikdglwknlnvtvsgldqlppqyrlspl

Timeline for d6d2ma1:

• d6d2ma1 is new in SCOPe 2.07-stable
  
• d6d2ma1 appears in the current release, SCOPe 2.08