SCOPe 2.07: Domain d5z7za1: 5z7z A:4-265

Lineage for d5z7za1 (5z7z A:4-265)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (124 species)
   not a true protein

7. Species Striga hermonthica [TaxId:68872] [278337] (16 PDB entries)

8. Domain d5z7za1: 5z7z A:4-265 [356907]
   Other proteins in same PDB: d5z7za2, d5z7zb2
   automated match to d4dnpa_
   complexed with edo, gol, peg

Details for d5z7za1

PDB Entry: 5z7z, 1.98 Å

PDB Description: crystal structure of striga hermonthica dwarf14 (shd14)

PDB Compounds: (A:) Dwarf 14

SCOPe Domain Sequences for d5z7za1:

Sequence; same for both SEQRES and ATOM records:

>d5z7za1 c.69.1.0 (A:4-265) automated matches {Striga hermonthica [TaxId: 68872]}
sllealnvrvvgsgekvlvlahgvgtdqsawqrilpyfvrdhrvvlydlvcagsvnpdyf
dfrrytsldafvddllaildalrlgrctyvghsvsasigilasirrpdlfakliligasp
rflndknyhggfadgeidtvfaameanyaawvsgfaplavgadvpeavrefsrtlfnmrp
ditlfvsrmvfnsdlrgvlglvtvpcsvlqtskdhsvpesmaaylkenlggrttvhmldi
eghlphlsapnllaqelrralp

Timeline for d5z7za1:

• d5z7za1 is new in SCOPe 2.07-stable
  
• d5z7za1 appears in the current release, SCOPe 2.08