SCOPe 2.07: Domain d2puea2: 2pue A:59-340

Lineage for d2puea2 (2pue A:59-340)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)

6. Protein Purine repressor (PurR), C-terminal domain [53835] (1 species)

7. Species Escherichia coli [TaxId:562] [53836] (24 PDB entries)

8. Domain d2puea2: 2pue A:59-340 [35682]
   Other proteins in same PDB: d2puea1
   protein/DNA complex; complexed with ade

Details for d2puea2

PDB Entry: 2pue, 2.7 Å

PDB Description: crystal structure of the laci family member, purr, bound to dna: minor groove binding by alpha helices

PDB Compounds: (A:) protein (purine repressor )

SCOPe Domain Sequences for d2puea2:

Sequence; same for both SEQRES and ATOM records:

>d2puea2 c.93.1.1 (A:59-340) Purine repressor (PurR), C-terminal domain {Escherichia coli [TaxId: 562]}
tksigllatsseaayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdg
llvmcseypepllamleeyrhipmvvmdwgeakadftdavidnafeggymagryliergh
reigvipgpleqntgagrlagfmkameeamikvpeswivqgdfepesgyramqqilsqph
rptavfcggdimamgalcaademglrvpqdvsligydnvrnaryftpalttihqpkdslg
etafnmlldrivnkreepqsievhprlierrsvadgpfrdyr

Timeline for d2puea2:

• d2puea2 first appeared (with stable ids) in SCOP 1.55
  
• d2puea2 appears in SCOPe 2.06
  
• d2puea2 appears in the current release, SCOPe 2.08