Lineage for d6at2a2 (6at2 A:228-540)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2519433Fold c.91: PEP carboxykinase-like [53794] (1 superfamily)
    contains a P-loop NTP-binding motif; mixed beta-sheet folds into a barrel-like structure with helices packed on one side
  4. 2519434Superfamily c.91.1: PEP carboxykinase-like [53795] (3 families) (S)
  5. 2519435Family c.91.1.1: PEP carboxykinase C-terminal domain [53796] (3 proteins)
  6. 2519528Protein automated matches [257345] (3 species)
    not a true protein
  7. 2519535Species Escherichia coli [TaxId:83333] [350201] (7 PDB entries)
  8. 2519538Domain d6at2a2: 6at2 A:228-540 [356681]
    Other proteins in same PDB: d6at2a1, d6at2a3
    automated match to d2olra1
    complexed with atp, mg, mn, thj, trs; mutant

Details for d6at2a2

PDB Entry: 6at2 (more details), 1.44 Å

PDB Description: e. coli phosphoenolpyruvate carboxykinase g209n mutant bound to thiosulfate
PDB Compounds: (A:) Phosphoenolpyruvate carboxykinase (ATP)

SCOPe Domain Sequences for d6at2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6at2a2 c.91.1.1 (A:228-540) automated matches {Escherichia coli [TaxId: 83333]}
iasmhcsanvgekgdvavffglsgtgkttlstdpkrrligddehgwdddgvfnfeggcya
ktiklskeaepeiynairrdallenvtvredgtidfddgsktentrvsypiyhidnivkp
vskaghatkvifltadafgvlppvsrltadqtqyhflsgftaklagtergiteptptfsa
cfgaaflslhptqyaevlvkrmqaagaqaylvntgwngtgkrisikdtraiidailngsl
dnaetftlpmfnlaiptelpgvdtkildprntyaspeqwqekaetlaklfidnfdkytdt
pagaalvaagpkl

SCOPe Domain Coordinates for d6at2a2:

Click to download the PDB-style file with coordinates for d6at2a2.
(The format of our PDB-style files is described here.)

Timeline for d6at2a2: