Lineage for d6asna1 (6asn A:7-227)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2527952Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
    contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain
  4. 2527953Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families) (S)
  5. 2527954Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (3 proteins)
  6. 2528047Protein automated matches [257342] (3 species)
    not a true protein
  7. 2528054Species Escherichia coli [TaxId:83333] [350199] (7 PDB entries)
  8. 2528060Domain d6asna1: 6asn A:7-227 [356673]
    Other proteins in same PDB: d6asna2, d6asna3
    automated match to d1os1a2
    complexed with 03s, so4; mutant

Details for d6asna1

PDB Entry: 6asn (more details), 1.55 Å

PDB Description: e. coli phosphoenolpyruvate carboxykinase k212i f216v mutant bound to methanesulfonate
PDB Compounds: (A:) Phosphoenolpyruvate carboxykinase (ATP)

SCOPe Domain Sequences for d6asna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6asna1 c.109.1.1 (A:7-227) automated matches {Escherichia coli [TaxId: 83333]}
ltpqeleaygisdvhdivynpsydllyqeeldpsltgyergvltnlgavavdtgiftgrs
pkdkyivrddttrdtfwwadkgkgkndnkplspetwqhlkglvtrqlsgkrlfvvdafcg
anpdtrlsvrfitevawqahfvknmfirpsdeelagfkpdfivmngakctnpqwkeqgln
senfvafnltermqliggtwyggemikgmvsmmnyllplkg

SCOPe Domain Coordinates for d6asna1:

Click to download the PDB-style file with coordinates for d6asna1.
(The format of our PDB-style files is described here.)

Timeline for d6asna1: