Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily) contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain |
Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families) |
Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (3 proteins) |
Protein automated matches [257342] (3 species) not a true protein |
Species Escherichia coli [TaxId:83333] [350199] (7 PDB entries) |
Domain d6asna1: 6asn A:7-227 [356673] Other proteins in same PDB: d6asna2, d6asna3 automated match to d1os1a2 complexed with 03s, so4; mutant |
PDB Entry: 6asn (more details), 1.55 Å
SCOPe Domain Sequences for d6asna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6asna1 c.109.1.1 (A:7-227) automated matches {Escherichia coli [TaxId: 83333]} ltpqeleaygisdvhdivynpsydllyqeeldpsltgyergvltnlgavavdtgiftgrs pkdkyivrddttrdtfwwadkgkgkndnkplspetwqhlkglvtrqlsgkrlfvvdafcg anpdtrlsvrfitevawqahfvknmfirpsdeelagfkpdfivmngakctnpqwkeqgln senfvafnltermqliggtwyggemikgmvsmmnyllplkg
Timeline for d6asna1: