SCOPe 2.07: Domain d5yvda2: 5yvd A:188-341

Lineage for d5yvda2 (5yvd A:188-341)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.294: EndoU-like [142876] (1 superfamily)
   comprises several helices and two three-stranded antiparallel beta-sheets; similar architecture to the RNase A-like fold (54075)

4. Superfamily d.294.1: EndoU-like [142877] (3 families)
   similarity to the RNase A-like superfamily (54076) extends to the active site location and architecture; the two structural cores of the RNase A and EndoU superfamilies are interrelated by a topological permutation - transposition of two pereferial beta-strands, suggesting possible distant homology of the two superfamilies (and their unification in a hyperfamily)

5. Family d.294.1.0: automated matches [356574] (1 protein)
   not a true family

6. Protein automated matches [356575] (3 species)
   not a true protein

7. Species Middle east respiratory syndrome-related coronavirus [TaxId:1335626] [356576] (1 PDB entry)

8. Domain d5yvda2: 5yvd A:188-341 [356653]
   Other proteins in same PDB: d5yvda1, d5yvdb1
   automated match to d2h85a2
   complexed with gol

Details for d5yvda2

PDB Entry: 5yvd, 2.7 Å

PDB Description: structural and biochemical characterization of endoribonuclease nsp15 encoded by middle east respiratory syndrome coronavirus

PDB Compounds: (A:) Nsp15

SCOPe Domain Sequences for d5yvda2:

Sequence; same for both SEQRES and ATOM records:

>d5yvda2 d.294.1.0 (A:188-341) automated matches {Middle east respiratory syndrome-related coronavirus [TaxId: 1335626]}
eciytqsrscsdflplsdmekdflsfdsdvfikkyglenyafehvvygdfshttlgglhl
liglykrqqeghiimeemlkgsstihnyfitetntaafkavcsvidlklddfvmilksqd
lgvvskvvkvpidltmiefmlwckdgqvqtfypr

Timeline for d5yvda2:

• d5yvda2 is new in SCOPe 2.07-stable
  
• d5yvda2 appears in the current release, SCOPe 2.08