SCOPe 2.07: Domain d5octa1: 5oct A:1-168

Lineage for d5octa1 (5oct A:1-168)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (80 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (34 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (286 PDB entries)

8. Domain d5octa1: 5oct A:1-168 [356619]
   Other proteins in same PDB: d5octa2, d5octb2, d5octc2, d5octd2, d5octe2, d5octf2
   automated match to d4obea_
   complexed with 9r5, dms, gnp, mg, peg

Details for d5octa1

PDB Entry: 5oct, 2.07 Å

PDB Description: discovery of small molecules binding to kras via high affinity antibody fragment competition method.

PDB Compounds: (A:) GTPase KRas

SCOPe Domain Sequences for d5octa1:

Sequence; same for both SEQRES and ATOM records:

>d5octa1 c.37.1.8 (A:1-168) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
heeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdl
psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhke

Timeline for d5octa1:

• d5octa1 is new in SCOPe 2.07-stable
  
• d5octa1 appears in the current release, SCOPe 2.08