Lineage for d3gbpa_ (3gbp A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520303Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2520304Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2520305Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)
  6. 2520334Protein Galactose/glucose-binding protein [53830] (2 species)
  7. 2520345Species Salmonella typhimurium, strain lt2 [TaxId:90371] [53832] (4 PDB entries)
  8. 2520350Domain d3gbpa_: 3gbp A: [35661]
    complexed with bgc, ca

Details for d3gbpa_

PDB Entry: 3gbp (more details), 2.4 Å

PDB Description: structure of the periplasmic glucose/galactose receptor of salmonella typhimurium
PDB Compounds: (A:) galactose-binding protein

SCOPe Domain Sequences for d3gbpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gbpa_ c.93.1.1 (A:) Galactose/glucose-binding protein {Salmonella typhimurium, strain lt2 [TaxId: 90371]}
trigvtiykyddnfmsvvrkaiekdgksapdvqllmndsqndqskqndqidvllakgvka
lainlvdpaaagtviekargqnvpvvffnkepsrkaldsydkayyvgtdskesgviqgdl
iakhwqanqgwdlnkdgkiqyvllkgepghpdaearttyvvkelndkgiqteqlaldtam
wdtaqakdkmdawlsgpnankievvianndamamgavealkahnkssipvfgvdalpeal
alvksgamagtvlndannqakatfdlaknlaegkgaadgtswkienkivrvpyvgvdkdn
lseft

SCOPe Domain Coordinates for d3gbpa_:

Click to download the PDB-style file with coordinates for d3gbpa_.
(The format of our PDB-style files is described here.)

Timeline for d3gbpa_: