SCOPe 2.07: Domain d5zgvb_: 5zgv B:

Lineage for d5zgvb_ (5zgv B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.0: automated matches [191360] (1 protein)
   not a true family

6. Protein automated matches [190418] (31 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [189718] (103 PDB entries)

8. Domain d5zgvb_: 5zgv B: [356595]
   automated match to d4eyba_
   complexed with gol, oh, zn

Details for d5zgvb_

PDB Entry: 5zgv, 1.15 Å

PDB Description: crystal structure of ndm-1 at ph8.0 (tris) with 2 molecules per asymmetric unit

PDB Compounds: (B:) Metallo-beta-lactamase type 2

SCOPe Domain Sequences for d5zgvb_:

Sequence; same for both SEQRES and ATOM records:

>d5zgvb_ d.157.1.0 (B:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
geirptigqqmetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlv
vdtawtddqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnql
apqegmvaaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggc
likdskakslgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadk
lr

Timeline for d5zgvb_:

• d5zgvb_ is new in SCOPe 2.07-stable
  
• d5zgvb_ appears in the current release, SCOPe 2.08